via order call : 081990004933 { 29a5e24d }
info lengakap produk kami www.grahaherbal.com.com

VACUM/alat terapi ******** dan mengencangkan payu dara

Negara Asal :Taiwan.

Harga :Rp.350.000,-

Jumlah : 1 paket terdiri dari2 tabung payudara

Beberapa wanita diantaranya mempunyai bentuk payudara yang kecil, menyamping, kendor dan turun.
Produk yang kami tawarkan adalah produk dari taiwan dengan metode teknologi tinggi yang telah di perbarui para ilmuwan untuk menciptakan dan memelihara kesehatan, ke indahan tubuh.
Amerika juga ikut mematenkan produk ini karna sangat handal dalam pencampean ke indahan bentuk payudara dan kesehatan.

Didalam kegunaannya produk ini sangat meyakinkan sehingga dalam waktu yang relatif singkat telah terbukti berhasil dengan sempurna di bandingkan produk-produk lain.

Cara Pengunaan Vakum Payudara :
– pasang pompa karet, selang dan tabung payudara.
– oleskan cream payudara yang ada dalam satu paket untuk mencegah gesekan dengan kulit.
– tekan **** tabung payudara agar mencegah masuknyaangin.
– tekan pompaagar udara keluar sampai payudara membesar kurang lebih 2cm ( lihat ukuran pada tabung payudara) .
– perlahan-lahan lepaskan pengontrol udara untuk membiarkan udara masuk dan mereleksasikan payudara.
– lakukanmetodediatasselama5-10menit. setiap pagi dan sore hari selama berkelanjutan.

Ukur payudara dengan memberi tanda pada tabung payudara, untuk membandingkan.
-lihat hasilnya selama 7hari pemakaian, bandingkan ukuran payudara sebelum dan sesudah pemakaian.

Fungsi Dan Kegunaan :
-memperbesarpayudara dan perawatan.
-untukpembentukanputingpayudaraagartidakmelesakkedalam.
-menambahrangsanganpadapayudara, menghilangkanfrigitpadawanita.
-memerahkanputingdanmencegahpenyakitkangkerpayudara.
-mempertahankanbentukpayudaraagartetaptegak, kencang dan indah dilihat.

Penggunaan Vakum Payudara Menambah Percaya Diri….

Di Kagumi Suami Untuk Keharmonisan Pasutri….

Penting…!!*VAKUM PAYUDARA* tidak boleh dipake orang lain untuk mencegah penyakit kulit.
jangan gunakan *Vakum Payudara* saat hamil.

cara pemesanan

1. Pemesanan barang bisa via SMS
Format: Nama Lengkap – Alamat Lengkap – Nama Item – Jumlah Item
Contoh: nia riyanty – Jl Sunter Paradise 6 Blok F 11/ No 22, jakarta Utara – vacum payu dara-1

2. Konfirmasi setelah melakukan transfer:
Format: Sudah Transfer – Jumlah – Nama Pemilik Rekening – Nama Bank
Contoh: Sudah Transfer – Rp. 350,000 – nia riyanty- BRI

Kirim ke:

081990004933

3. Proses pembayaran bs lewat via transfer atau setor tunai : MANDIRI,BRI,BNI,BCA sesuai rekomendasi anda.

4.setelah anda konfirmasi pembayaran kami akan packing /kirim brg ke alamat anda,dan kami akan kirim no resi ekspedisi kepada anda sbg bukti bahwa kami sudah mengirimkan brg kpd anda dan untuk pengecekan pengiriman brg sampe pd tujuan.

KEPUASAN KONSUMEN YANG KAMI UTAMAKAN terima kasih

SEDIA : ********* ***, SUPLEMEN ******** ***** , PELANGSING BADAN , PENGGEMUK BADAN, PEMUTIH BADAN/WAJAH, ********** WANITA, SEXTOYS p/w. dll …click aja www.grahaherbal.com

Share and Enjoy:
  • Print
  • Facebook
  • Google Bookmarks
  • email
  • MySpace
  • RSS
  • Twitter
  • Yahoo! Bookmarks
loading...
Pasang Iklan Koran Majalah dan Tabloid

Pasang Iklan Media Cetak

Iklan koran-Kolom-Display Seluruh Indonesia (kompas,poskota,media indonesia, koran jakarta, dll) :

Langkah pemasangan iklannya mudah

1. Visit ke http://media.pasangiklan.net
2. Isi materi iklan anda sesuai dengan jumlah baris yg anda inginkan
3. Setelah isi materi iklan, submit bisa daftar atau tanpa daftar
4. Konfirmasi Pembayaran
5. Iklan anda tayang sesuai dengan waktu yang anda pilih

Mudah kan? segera pasang iklan media cetak dengan mengklik link dibawah ini

Klik Disini

Pasang Iklan Gratis
Pasang Iklan anda Disitus Kami Yang lainnya :

PeluangIklan.com

IklanJualBeli.net

PasangIklanBisnis.net

RumahYangDijual.com

Our Partner Services

Hosting Website & Domain Services

Jaringan Pasang Iklan

Iklan Anda mau ikut tampil di Jaringan Kami, seperti iklan dibawah ini ? Click here

Form Pasang Iklan

Nama:

Email:

URL Website:

Judul Iklan:

Diskripsi:

Isi Iklan:

Banner (125x125):

Kategori:

Iklan Sponsor
Iklan Banner Sponsor
NextgTravel
Iklan Banner sponsor
Statistik Pengunjung
Flag Counter
Anda puas dgn layanan kami, silahkan "Like us"